Search Courses

Please use the following search facility to find the course/s you are looking for.

If you are unsure as to which course you require, please contact us either by telephone on +44 (0)208 335 5919 or Email us at Enquiries@EntegratyLS.Com
.

Filter Options

Course Code:		[All Course Codes] ACT0001APPSENSEBCCPA01BCCPP01BCWAA01BCWAP01CHKPT01CHKPT02CHKPT03CHKPT04CHKPT05CHKPT06CHKPT07CHKPTNOCMPA+ACCMPA+ELCMPA+ESCMPNET+CMPPROJCMPSEC+CMPSERVCRSBM01CRSBM02CRSBM03CRYV10ACRYV10ICRYV11ACRYV11ICRYV9INCSCACCMCSCASRFCSCBMSNCSCBSCICSCCASICSCCBGPCSCCCIECSCCCNACSCCHIPCSCCIDCCSCCIPSCSCCND1CSCCND2CSCCNFCCSCCQOSCSCCSNDCSCCSNPCSCCUCSCSCCUWNCSCCWAACSCCWLFCSCDCISCSCDCNSCSCFXFECSCGWGKCSCICM1CSCICSNSCSCIP42CSCIP52CSCIPCCCSCIPCECSCIPT4CSCIPT5CSCIPTDCSCIPTXCSCMARSCSCMDS9CSCMPLSCSCMSNFCSCOCCNCSCSAESCSCSCWACSCSND1CSCSNDECSCSNPACSCSNRSCSCSSSECSCSVPNCSCUCDNCSCUCSECSCVOICCSCWENTCSCWFSSCSCWLATCSCWLSECTX1012CTX1223CTX1252CTX1256CTX1258CTX1259CTX1266CTX1308CTX1309CTX1327CTX1456CTX1730CTX1731CTX4100CTX41SUCTX6113CTX6114DAPA0VBDAPA2L1DAPA2L2DAPA2L3DAPA3L1DAPA3L2DAPA3L3DAPA3VBDAPA7L1DAPA7L2DAPA7L3DAPA97IDAPAC0ADAPAC0IDAPAC0MDAPE0ADDAPE0INDAPE0MEDAPE0VBDAPE2L1DAPE2L2DAPE2L3DAPE3L1DAPE3L2DAPE3L3DAPE3VBDAPE7L1DAPE7L2DAPE7L3DAPE97ADAPE97DDAPE97PDAPE97VDAPF0ADDAPF0INDAPF2L1DAPF2L2DAPF3L1DAPF3L2DAPO0IMDAPO2L1DAPO2L2DAPO2L3DAPO3L1DAPO3L2DAPO3L3DAPO7L1DAPO7L2DAPO7L3DAPOFF7DAPP0ADDAPP0IMDAPP0INDAPP2L1DAPP2L2DAPP3L1DAPP3L2DAPP7L1DAPP7L2DAPP97EDAPP97IDAPPCF1DAPR0ADDAPR0IMDAPR0INDAPR2L1DAPR2L2DAPR3INDAPR3L1DAPR3L2DAPR7L1DAPU0INDAPV0INDAPV2L1DAPV2L2DAPV2SBDAPV3ADDAPV3INDAPW0ADDAPW0IMDAPW0INDAPW2L1DAPW2L2DAPW2L3DAPW3L1DAPW3L2DAPW3L3DAPW3VBDAPW7L1DAPW7L2DAPW7L3DAPW97ADAPW97IDCMNEPRDCMVOIPF5XBIPAF5XBIPEF5XFRPSFORADCOFORSNDVGENSQLIINTPPROISBITSRISSDSKPISSNIAGISSSPADISSSPINISSSRVPITL1DAWITLAWV3ITLBM23ITLCMEXITLCMEXITLFB23ITLFCV3ITLFND2ITLPMEXITLSDIMITLSMCFITLSMCMITLSMPMITLSMSDITLSMSDITLSMSLITLSMSSJUNAIPSJUNAJSAJUNATPRJUNCJSAJUNCNJFJUNFRVPJUNIIDPJUNINAAJUNNAAPJUNSMF1LGCACDTLGCCFCPLGCCNCPLGCOODCLGCPRG1LGCXML1LGCXML2LGCXML3LOT6310LOT6510LOT6610LOT6750LOT6760LOT6760LOT6770LOT8420LOT8510LOT8520LOT8720LOT8750LOT8760LOT8770LOTBESCLOTD510LOTD520LOTD540LOTD750LOTD760LOTD770MACMX4AMACMX4IMCS03ACMCS03L1MCS03L2MCS2008MCS2009MCS2011MCS2014MCS2028MCS2030MCS2071MCS2072MCS2073MCS2074MCS2087MCS2092MCS2124MCS2126MCS2151MCS2152MCS2207MCS2208MCS2209MCS2210MCS2261MCS2262MCS2272MCS2273MCS2274MCS2275MCS2276MCS2277MCS2278MCS2279MCS2282MCS2283MCS2285MCS2287MCS2289MCS2297MCS2310MCS2311MCS2349MCS2364MCS2373MCS2389MCS2395MCS2400MCS2433MCS2439MCS2524MCS2541MCS2542MCS2543MCS2544MCS2546MCS2547MCS2548MCS2549MCS2550MCS2553MCS2554MCS2555MCS2557MCS2559MCS2565MCS2576MCS2596MCS2597MCS2609MCS2640MCS2663MCS2667MCS2710MCS2717MCS2733MCS2734MCS2778MCS2779MCS2780MCS2781MCS2782MCS2783MCS2784MCS2786MCS2787MCS2788 MCS2789 MCS2790 MCS2791MCS2792MCS2793MCS2794MCS2795MCS2796MCS2797MCS2810MCS2820MCS2821MCS2823MCS2824MCS2830MCS2933MCS2934MCS2956MCS2957MCS3041MCS3938MCS4994MCS4995MCS5047MCS5049MCS5050MCS5051MCS5053MCS5054MCS5058MCS5060MCS5061MCS5105MCS5115MCS5116MCS5118MCS5119MCS5177MCS5178MCS5179MCS5657MCS6415MCS6417MCS6418MCS8019MCS8309MCS8329MCS8332MCS8333MCS8334MCS8337MCS8338MCS8339MCS8339MCS8340MCS8341MCS8342MCS8343MCS8344MCS8345MCS8346MCS8347MCS8348MCS8349MCS8351MCS8352MCS8353MCS8354MCS8355MCS8356MCS8359MCS8362MCS8364MCS8365MCS8366MCS8371MCS8372MCS8375MCS8376MCS8381MCS8382MCS8384MCS8387MCS8388MCS8389MCS8390MCS8391MCS8392MCS8393MCS8394MCS8395MCS8397MCS8398MCS8399MCS8400MCS8402MCS8403MCS8404MCS8405MCS8419MCS8420MCS8421MCS8422MCS8423MCS8424MCS8455MCS8456MCS8472MCS8505MCS8506MCS8507MCS8508MCS8509MCS8510MCS8511MCS8512MCS8513MCS8514MCS8515MCS8516MCS8517MCS8518MCS8519MCS8520MCS8521MCS8522MCS8523MCS8524MCS8525MCS8526MCS8529MCS8530MCS8536MCS8537MCS8538MCS8539MCS8540MCS8541MCS8594MCS8595MCS8596MCS8597MCS8598MCS8599MCS8621MCS8622MCS8623MCS8624MCS8625MCS8626MCS8627MCS8628MCS8629MCS8629MCS8630MCS8631MCS8632MCS8633MCS8634MCS8635MCS8637MCS8639MCS8640MCS8641MCS8642MCS8643MCS8644MCS8645MCS8646MCSB096MCSB166MCSCLUSMCSNAV4MCSO7SPMCSO7SYMCSSG41MCSSPS3MIME001MIME002MIME003MIME004MIME005MIME006MIME007MIME008NGS0001NGS0002NGS0003NOKENMNNOKIPSONOKMUDSNOKNSACNOKNSAFNOKNSAHNOKNSAONOV3057NOV3063NOV3067NOV3067NOV3071NOV3072NOV3073NOV3074NOV3075NOV3077NOV3080NOV3081NOV3082NOV3083NOV3086NOV3089NOV3091NOV3091NOVZCM1ORC10BRORC10GDORC10GQORC10J2ORC10PAORC10PLORC10SQORC10STORC10W1ORC10W2ORC12A1ORC12A2ORC9IPLORC9SQLORCDBFIORCDBIIOSUADPROSUPERPPACOISHPACRCV3PACTTATPACTTS1PBPADDEPBPADFTPBPAE2PBPAEX2PBPBSAUPBPICS2PBPMBP2PBPMBPEPBPOOPRPBPOOU1PBPOOU2PBPQAS2PBPQASMPBPQASRPBPQPBPPBPREQ2PBPREQXPBPSDE2PBPSDEXPBPSDITPBPSDIXPBPSMTSPBPSMTUPBPSMUXPBPSMXPBPSTF2PBPSTSTPBPTOC1PBPTOCXPBPTTT3PBPUAT2PBPUCC2PNTSEC1PRJFPM3PRMFPM3PRMFPM3PRMMPPEPRMPJMNPRMPL-2PRMPMC1PRMPMFNPRMPMIPPRMPMP3PRMPMP5PRMPMPXPRMPMX5PRMPPCMPRMRMW1QAI2K82QAI2K83QAI2K84QAI2K85QAI2K86QAI2K87QAIAASRQAIACS2QAIADJVQAIAMJEQAIAOINQAIASM2QAIASPVQAIASSAQAIASVSQAIAYBCQAIBALEQAIC#PLQAICFPEQAICLU3QAICOEFQAICOPCQAICPREQAICSKIQAIDAJWQAIEN2FQAIEWSIQAIFAV5QAIFNFMQAIFWO2QAIFWORQAIHTM4QAIIGTAQAIIHRPQAIISA6QAIITFUQAIITSEQAIJ2MEQAIJFCPQAIJNCPQAIJPDVQAIJWDWQAILHELQAILMTEQAIMBC1QAIMDSIQAIMMEEQAIMOM5QAIMOSPQAIMP3PQAIMRECQAIMTTEQAINET2QAINETUQAINWWIQAIOM5AQAIOOJVQAIOPOLQAIOYTIQAIPHPIQAIPMNPQAIPNEGQAIPREDQAIPVBAQAIPWIMQAIQAUTQAIS7SAQAISBCOQAISCRIQAISP3AQAISP3DQAISP7OQAISP7UQAISPMDQAISREAQAISSAIQAISSUCQAISUTMQAITBLDQAITBPRQAITTL2QAIUEJBQAIUPCOQAIVB5PQAIVB6PQAIVBEXQAIVN6AQAIVTEAQAIW2K8QAIWFREQAIWPDRQAIWPFRQAIWS3HQAPMCPQAPMCXQAPMSPFQAPMSPPQAPP2FNQAPP2FPQAPP2GBQAPP2RWQAPV2PPQAUADDTQAUBASHQAUFUNDQAULXADQAULXESQAUMUSHQAUPDBIQAUPERL5QAUUXPRQAUUXSARDSDBADRDSEDWCRDSSQL5RDSSQLARDSSQLERDSSQLLSCPASIKSCPASIVSCPESSKSCPESSVSCPNPCMSCPSECCSCPSECESCPSISESCPSISISCPSISKSCPTPDESCPTPDISCPTPDKSOL10PTSOLMT10TRICAUEVMWDSANVMWEIC3VMWFASTVMWOPS3WBTADRPWBTTPESWEBWCEWWEBWSECXENSRCT
Course Name:		[All Courses] 1 Day Microsoft Vista WorkshopAccelerated Migration to ASP.NAccelerated Migration to JavaAccess 2000 AdvancedAccess 2000 IntermediateAccess 2000 IntroductionAccess 2000 VBAAccess 2002 Level 1Access 2002 Level 2Access 2002 Level 3Access 2003 Level 1Access 2003 Level 2Access 2003 Level 3Access 2003 VBAAccess 2007 Level 1Access 2007 Level 2Access 2007 Level 3ActivIdentity Secure Remote AcAdministering a Microsoft SQLAdministering and Automating MAdministering Cisco CallManageAdministering IBM Lotus DominoAdministering IBM Lotus DominoAdministering IBM Lotus DominoAdministering IBM Lotus DominoAdministering Microsoft SharePAdministering Microsoft WindowAdministration in Microsoft DyAdvanced C++ Development TechnAdvanced Consulting SkillsAdvanced Data Access DevelopmeAdvanced Database SecurityAdvanced Distributed ApplicatiAdvanced Foundations of MicrosAdvanced JavaAdvanced Juniper Networks IPSeAdvanced Juniper Networks SecuAdvanced Linux AdministrationAdvanced Network InfrastructurAdvanced Perl with CGI and WebAdvanced Scripting For WindowsAdvanced Switching and RoutingAdvanced Transact-SQL ProgrammAdvanced Unix Data Tools & TecAdvanced Web Application DevelAdvanced Web Application DevelAdvanced Windows Application DAironet Wireless LAN FundamentAn Introduction to Scripting FAnalyzing Requirements and DefAPM Introductory Certificate iAPMP ExamAPMP Examination Preparation WAPMPAPMP5 ExamApplication Development UsingAppSenseArchitecture and Design of DisArt of Amazing ServiceAssert Yourself and Build ConfAttack Prevention with JuniperAxapta 3.0 AdministrationAxapta 3.0 Bill of MaterialsAxapta 3.0 CRMAxapta 3.0 Development IAxapta 3.0 Development IAxapta 3.0 Development IIAxapta 3.0 Development IIIAxapta 3.0 Development IVAxapta 3.0 Enterprise Portal DAxapta 3.0 Fixed AssetsAxapta 3.0 HRMAxapta 3.0 Install & ConfiguraAxapta 3.0 Install & ConfiguraAxapta 3.0 IntroductionAxapta 3.0 Master PlanningAxapta 3.0 Production 1Axapta 3.0 Production 2Axapta 3.0 Project IAxapta 3.0 Project IIAxapta 3.0 Sales and MarketingAxapta 3.0 SalesAxapta 3.0 Trade and LogisticsAxapta 3.0 Trade and LogisticsAxapta 3.0 Warehouse ManagemenBasic Administration of MicrosBeing a LeaderBill of Material - Microsoft DBlue Coat Certified Proxy AdmiBlue Coat Certified Proxy ProfBlue Coat WAN Acceleration AdmBlue Coat WAN Acceleration ProBuilding an Effective Web SiteBuilding Applications for theBuilding Applications for theBuilding COM+ Applications UsiBuilding Effective ASP.NET 2 WBuilding Multilayer SwitchingBuilding Scalable Cisco InternBuilding the IBM Lotus DominoBuilding the IBM Lotus DominoBusiness Analysis Essentials EBusiness Analysis EssentialsBusiness Portal 2.5 InstallatiBusiness Systems Analysis usinC ProgrammingC++ for C ProgrammersC++ for non-C ProgrammersCatalyst 6500 Implementation fCCIE Preparation LabCCNA Boot CampCheckPoint Certified SecurityCheckPoint Accelerated CCSE -CheckPoint Certified SecurityCheckPoint Certified SecurityCheckPoint IntegrityCheckPoint NGX Security AdminiCheckPoint Provider 1-NGXCheckPoint VSX NGXCisco Advanced Storage ImplemeCisco ICM Product Training parCisco IP Telephony DesignCisco IP Telephony ExpressCisco IP Telephony v4- Part 2Cisco IP Telephony V4Cisco IP Telephony v5- Part 2Cisco IP Telephony V5Cisco MDS Storage Networking FCisco Networking FundamentalsCisco Sales EssentialsCisco Secure Virtual Private NCisco Storage Network Design ECisco Unified Communication SyCisco Unified Wireless NetworkCisco Unity Design and NetworkCisco Voice Over IPCisco Wireless LAN Advanced ToCisco Wireless LAN FundamentalCitrix Access Gateway 4.5 AdvaCitrix Access Gateway 8.0 EnteCitrix Access Suite 4.0: BuildCitrix Access Suite 4:0 AnalysCitrix Access Suite 4:0 DesignCitrix Metaframe PresentationCitrix Metaframe PresentationCitrix Password Manager 4.5Citrix Platinum 4.5 CombinatioCitrix Presentation Server 4.0Citrix Presentation Server 4.5Citrix Presentation Server 4.5Citrix Presentation Server 4.5Citrix Presentation Server 4:Clearswift Email ApplianceClearswift Web ApplianceCoaching for PerformanceCOM Programming with C++Communicate EffectivelyCompTIA A+ Certification - AccCompTIA A+ Certification : EleCompTIA A+ Certification EssenCompTIA IT Project+CompTIA Network+ CertificationCompTIA Security+ CertificatioCompTIA Server+Configuring BGP on Cisco RouteConfiguring Juniper Networks FConfiguring Juniper Networks SConfiguring Windows Vista MobiConsulting SkillsCore Data Access with MicrosofCore Distributed Application DCore Foundations of MicrosoftCore Web Application DevelopmeCore Windows Application DevelCreating Reporting Solutions UCreative Positive RelationshipCrossbeam COS Principles of OpCrossbeam VSX WorkshopCrossbeam XOS Principles of OpCrystal Reports V10 AdvancedCrystal Reports V10 IntroductiCrystal Reports V11 AdvancedCrystal Reports V11 IntroCrystal Reports Version 9 IntrCustomizing Microsoft SharePoiDatabase Analysis and DesignDeploying and Managing BusinesDeploying Business Desktops wiDeploying Microsoft Office ProDeploying Microsoft Windows ViDeploying Microsoft Windows ViDeploying Windows Server 2008Designing a High AvailabilityDesigning a Messaging InfrastrDesigning a Microsoft SQL ServDesigning a Microsoft WindowsDesigning a Reporting SolutionDesigning an ETL Solution ArchDesigning an OLAP Solutions ArDesigning and Implementing OLADesigning and Managing a WindoDesigning and Planning an ExchDesigning Business IntelligencDesigning Cisco Network ServicDesigning for Cisco InternetwoDesigning High Availability SoDesigning Microsoft SQL ServerDesigning Microsoft SQL ServerDesigning Security for MicrosoDesigning Security for MicrosoDesigning the Data Tier for MiDesigning, Deploying, and ManaDeveloping Applications for JaDeveloping Business Process anDeveloping Dynamic Web ApplicDeveloping IBM Lotus Domino 6Developing Microsoft .NET AppDeveloping Microsoft .NET ApplDeveloping Microsoft ASP.NET WDeveloping Web Applications wiDeveloping Windows Forms ApplDeveloping XML Web Services UsDeveloping XML-Based ApplicatiDevelopment I in Microsoft DynDevelopment II in Microsoft DyDevelopment III in Microsoft DDevelopment IV in Microsoft DyDreamWeaver MX 2004 AdvancedDreamWeaver MX 2004 IntroductiEdgesight: 4.2 Application PerEffective Data Warehouse ConstEndpoint Security with PointseEnterprise .NET 2.0 FrameworkEnterprise Extraction, TransfoEssentials of Linux AdministraExcel 2000 AdvancedExcel 2000 IntermediateExcel 2000 IntroExcel 2002 Level 1Excel 2002 Level 2Excel 2002 Level 3Excel 2003 Level 1Excel 2003 Level 2Excel 2003 Level 3Excel 2003 VBAExcel 2007 Level 1Excel 2007 Level 2Excel 2007 Level 3Experience the 2007 MicrosoftExploring New Features of IBMExploring New Features in IBMF5 BIG-IP Local Traffic ManageF5 BIG-IP Local Traffic ManageF5 FirePassFacilitate WorkshopFacilitators WorkshopFinance for Non-Financial ManaFinancials I in Microsoft DynaFinancials I in Microsoft DynaFinancials II - Microsoft DynaFirst Look Getting Started witFirst Look Getting Started witFirst Look Getting Started witFirst Look Getting Started witFirst Look Getting Started witFirst Look Getting Started witFirst Look Getting Started witFirst Look: Getting Started wiFirst Look: Getting Started wiFirst Look: Getting Started wiFortinet FortiGate Multi-ThreaFortinet FortiGate Multi-ThreaFoundation Certificate in IT SFoundation Express for Field EFoundations of Novell Open EntFrontpage 2000 AdvancedFrontpage 2000 IntroductionFrontpage 2002 Level 1Frontpage 2002 Level 2Frontpage 2003 Level 1Frontpage 2003 Level 2FRx 6.7 Report Design EssentiaFRx 6.7 Report Design EssentiaFundamentals of IBM Lotus DomiFundamentals of IBM Lotus DomiFundamentals of Network SecuriFundamentals of Project manageFundamentals of Project ManageGetting Started with PHP andGetting the Best from PRINCE2Great Plains Project SeriesGreat Plains V8.0 Bank ReconciGreat Plains V8.0 Fixed AssetsGreat Plains V8.0 Foundation IGreat Plains V8.0 Foundation IGreat Plains V8.0 General LedgGreat Plains V8.0 General LedgGreat Plains V8.0 Human ResourGreat Plains V8.0 Human ResourGreat Plains V8.0 InstallationGreat Plains V8.0 IntegrationGreat Plains V8.0 Inventory CoGreat Plains V8.0 ManufacturinGreat Plains V8.0 Modifier witGreat Plains V8.0 Payables ManGreat Plains V8.0 Payables ManGreat Plains V8.0 PayrollGreat Plains V8.0 ReceivablesGreat Plains V8.0 ReceivablesGreat Plains V8.0 Report WriteGreat Plains V8.0 Sales OrderHalf Day ITIL Awareness V3Half Day ITIL Service ManagemeHelp Desk Support for IBM NotIBM Lotus Domino 7 System AdmiIBM Lotus Domino 8 System AdmiIdentify & Grow TalentImplementing and MaintainingImplementing & Administering SImplementing & Administering SImplementing & Supporting WindImplementing a Microsoft SQL SImplementing a Microsoft WindoImplementing and AdministeringImplementing and Maintaining AImplementing and Maintaining IImplementing and Maintaining MImplementing and Maintaining MImplementing and Maintaining TImplementing and Managing MicrImplementing Cisco Intrusion PImplementing Cisco MPLSImplementing Cisco Quality ofImplementing Cisco Storage NetImplementing Cisco Voice GatewImplementing Cisco works for LImplementing Microsoft ClusterImplementing Microsoft InterneImplementing Microsoft OfficeImplementing Microsoft OperatiImplementing Microsoft WindowsImplementing Microsoft WindowsImplementing Microsoft WindowsImplementing Novell Open EnterImplementing Secure ConvergedImplementing Windows Server 20Implementing, Managing and MaiImplementing, Monitoring, AnalInstall & Configuration - MicrInstalling and Configuring theInstalling, Configuring and AdIntegrating Juniper Networks FIntercompany in Microsoft DynaInterconnecting Cisco NetworkInterconnecting Cisco NetworkInternet Technology FundamentaInterview and Hire the Right PIntroduction to C# ProgrammingIntroduction to Consulting SkiIntroduction to Installing andIntroduction to Microsoft .NETIntroduction to Microsoft DynaIntroduction to Networking (NeIntroduction to Oracle 9i: SQLIntroduction to Parallel ProgrIntroduction to Programming MiIntroduction to Programming wiIntroduction to ProgrammingIntroduction to Script ProgramIntroduction to Visual Basic .IP Contact Centre EnterpriseIPCC 10 day Boot CampISA 2006 - New FeaturesISEB Business Analysis DiplomaISEB Certificate in Project MaISEB Certificate in Project MaISEB Foundation Certificate inISEB Managers Certifi cate inISEB Managers Certificate in IISS Advanced SiteProtector 2 SISS Desktop ProtectionISS Introduction To SiteProtecISS Network Intrusion ProventiISS Server ProtectionIT Security FundamentalsITIL Change Management ExamITIL Configuration ManagementITIL Foundation (2 Days)ITIL Problem Management ExamITIL Service Desk & Incident MITIL Service Management AwarenITIL SM Change ManagementITIL SM Configuration ManagemeITIL SM Problem ManagementITIL SM Service Desk & IncidenITIL SM Service Level ManagemeITIL V2-V3 Foundation BridgingITIL V2-V3 Managers Bridging CJava for C/C++ ProgrammersJava for non-C ProgrammersJava Primer for DevelopersJava Web Development WorkshopJuniper Implementing IntrusionJuniper Implementing the DX ApJuniper Security Manager FundaLead & Manage TeamsLegendary HelpdesksLotus Bespoke CoursesMaintaining a Microsoft WindowMaintaining and TroubleshootinMake a Business CaseMake the Transition to SolarisManage Outsourced Service ProvManage Projects Involving 3rdManage Relationships Enable ChManage the TeamManagers Certificate in IT SerManaging a Microsoft SQL ServeManaging a Microsoft Windows 2Managing a Microsoft Windows SManaging and Maintaining a MicManaging Difficult SituationsManaging IBM Lotus Domino 7 SeManaging IBM Lotus Domino 8 SeManaging MeetingsManaging Messaging Security UsManaging Microsoft Systems ManManaging People in a Project EManaging Successful ProgrammesManaging Successful ProgrammesManaging Your Infrastructure UMaster Planning in Microsoft DMastering BASH ScriptsMastering UNIX Shell ScriptsMCSE 2003 AcceleratorMDS 9000 Configuration & TroubMicrosoft Access 97 IntroductiMicrosoft Business Solutions -Microsoft Business Solutions -Microsoft Business Solutions -Microsoft Business Solutions -Microsoft CRM 1.2 ApplicationMicrosoft CRM 1.2 .Net Tools tMicrosoft CRM 1.2 IntegrationMicrosoft CRM 3.0 AdministratiMicrosoft CRM 3.0 CustomizatioMicrosoft CRM 3.0 Data MigratiMicrosoft CRM 3.0 InstallationMicrosoft CRM 3.0 Marketing AuMicrosoft CRM 3.0 Sales ManageMicrosoft CRM 3.0 Service ManaMicrosoft CRM 3.0 Service ScheMicrosoft Dynamics GP 9.0 BankMicrosoft Dynamics GP 9.0 BusiMicrosoft Dynamics GP 9.0 FielMicrosoft Dynamics GP 9.0 FielMicrosoft Dynamics GP 9.0 FielMicrosoft Dynamics GP 9.0 FielMicrosoft Dynamics GP 9.0 FielMicrosoft Dynamics GP 9.0 FielMicrosoft Dynamics GP 9.0 FixeMicrosoft Dynamics GP 9.0 FounMicrosoft Dynamics GP 9.0 FounMicrosoft Dynamics GP 9.0 GeneMicrosoft Dynamics GP 9.0 GeneMicrosoft Dynamics GP 9.0 InstMicrosoft Dynamics GP 9.0 InteMicrosoft Dynamics GP 9.0 InveMicrosoft Dynamics GP 9.0 ManuMicrosoft Dynamics GP 9.0 ModiMicrosoft Dynamics GP 9.0 PayaMicrosoft Dynamics GP 9.0 PayaMicrosoft Dynamics GP 9.0 ProjMicrosoft Dynamics GP 9.0 PurcMicrosoft Dynamics GP 9.0 ReceMicrosoft Dynamics GP 9.0 ReceMicrosoft Dynamics GP 9.0 RepoMicrosoft Dynamics GP 9.0 SaleMicrosoft Excel 2000 VBAMicrosoft Excel 97 AdvancedMicrosoft Excel 97 Data ManageMicrosoft Excel 97 PresentingMicrosoft Excel 97 Visual BasiMicrosoft Operations Manager (Microsoft Operations Manager (Microsoft Powerpoint 97 EnhancMicrosoft Powerpoint 97 IntrodMicrosoft Project 2003 Level 1Microsoft Project 2003 Level 2Microsoft Publisher 2000 IntroMicrosoft Retail Management SyMicrosoft Retail Management SyMicrosoft SoftGrid Platform V4Microsoft Visio 2000 IntroductMicrosoft Visio 2002 ProfessioMicrosoft Visio 2002 ProfessioMicrosoft Visio 2002 StandardMicrosoft Visual Basic ScriptiMicrosoft Windows 2000 NetworkMicrosoft Word 97 - IntroductiMicrosoft Word 97 AdvancedMigrating from Microsoft WindoMigrating to Novell Open EnterMIMEsweeper For SMTP 5.2 CMA tMIMEsweeper For SMTP 5.2 CMAMIMEsweeper For SMTP 5.2 CMEMIMEsweeper For WEB 5.2 CMA toMIMEsweeper For WEB 5.2 CMAMIMEsweeper For WEB 5.2 CMEModelling Business Processes EModelling Business ProcessesMonitoring and TroubleshootingNavision 4.0 Business AnalyticNavision 4.0 Commerce GatewayNavision 4.0 Commerce PortalNavision 4.0 Employee PortalNavision 4.0 Manufacturing CosNavision 4.0 Service ManagemenNavision V4.0 Business NotificNavision V4.0 Installation andNavision V4.0 Inventory CostinNavision V4.0 Inventory ManageNavision V4.0 Job CostingNavision V4.0 TradeNegotiate to Win-WinNetscaler 8.0: AdministrationNetscaler 8.0: Basic OperationNokia Enterprise ManagerNokia Intrusion Prevention SolNokia Multi Domain SecurityNovell eDirectory Design and INovell eDirectory Design and INovell Groupwise 7 AdministratNovell Identity Manager 3.5 FuNovell Identity Manager 3.5 FuNovell Open Enterprise ServerNovell Open Enterprise ServerNovell Zenworks ConfigurationNSA ConnectivityNSA FoundationNSA High AvailabilityNSA Optimisation and ScriptingObject Oriented Primer for SofObject-Oriented Design for C++Object-Oriented Design for JavOne Day ITIL Awareness V3OO Analysis & Design using theOperating Juniper Networks WXOptimising Converged Cisco NetOracle 10g Build J2EE ApplicatOracle 10G PL/SQL AdvancedOracle 9i Database AdministratOracle 9i: Program with PL/SQLOracle Applications Server 10gOracle Applications Server 10gOracle AS Discover 10g: CreateOracle Database 10g New FeaturOracle Database 10g: AdministrOracle Database 10g: AdministrOracle Database 10g: Program wOracle Database 10g: SQL TuninOracle Database 10G:IntroductiOracle Reports Developer 10g:Oracle9i Database AdministratiOrganisational PoliticsOrganise Your TimeOutlook 2000-IntermediateOutlook 2002 Level 1Outlook 2002 Level 2Outlook 2002 Level 3Outlook 2003 Level 1Outlook 2003 Level 2Outlook 2003 Level 3Outlook 2007 Level 1Outlook 2007 Level 2Outlook 2007 Level 3Packeteer Operating with iSharPacketeer PacketShaper TechnicPacketeer PacketShaper TechnicPacketeer ReportCenter VersionPC Fundamentals V10.4Perl 5 Object Oriented ProgramPerl ProgrammingPersuasive NegotiationsPlanning & Deploying MicrosoftPlanning and Maintaining a MicPlanning, Implementing and MaiPlanning, Implementing, ManagiPMI PMP Examination PreparatioPolestar IT Service ManagementPopulating a Data Warehouse wiPowerPoint 2000 AdvancedPowerPoint 2000 IntermediatePowerPoint 2000 IntroductionPowerPoint 2002 Level 1PowerPoint 2002 Level 2PowerPoint 2003 Level 1PowerPoint 2003 Level 2PowerPoint 2007 Level 1PowerPoint 2007 Level 2Present with ImpactPRINCE2 - Foundation and PractPRINCE2 - FoundationPRINCE2 - PractitionersPRINCE2 - Re-registration ExamProcess RedesignProduction Series I in MicrosoProduction Series II in MicrosProgramming a Microsoft SQL SeProgramming with C#Programming with J2MEProgramming with Microsoft ADOProgramming with Microsoft VisProgramming with the MicrosoftProgramming with the MicrosoftProgramming with XML in the MiProject 2000 AdvancedProject 2000 IntermediateProject 2000 IntroductionProject 2002 Level 1Project 2002 Level 2Project 2003 Level 1Project 2003 Level 2Project 2007 Level 1Project Accounting I in MicrosProject Accounting II in MicroProject LeadingProject Management for Non-ProProject Management FundamentalProject ManagementProject Master ClassProject Planning and Control wPublisher 2003 IntroQuerying Microsoft SQL 2000 wiRecovering Messaging Servers aReporting and Business AnalysiRequirements Engineering ExamRequirements EngineeringRisk Management WorkshopSales and Marketing in MicrosoSCP Advanced Security ImplemenSCP Advanced Security ImplemenSCP Enterprise Security SolutiSCP Enterprise Security SolutiSCP Security Awareness e-LearnSCP Security Awareness in CD FSCP Strategic Infrastructure SSCP Strategic Infrastructure SSCP Strategic Infrastructure SSCP Tactical Perimeter DefenseSCP Tactical Perimeter DefenseSCP Tactical Perimeter DefenseSCP TPD & SIS Combo PackScripting Microsoft Windows MaSecure Web Applications DesignSecuring Cisco Network DevicesSecuring Cisco Network DevicesSecuring Hosts using Cisco SecSecuring Networks with Cisco RSecuring Networks with PIX andSecuring Networks with PIX andSecurity Solutions for SystemsService Management in MicrosofSharePoint 2003 - Overview forSharePoint 2003 Site AdministrSharePoint 2007 for End UsersSharepoint 2007 for Site AdminSharePoint 2007 OverviewSoftware Testing FoundationSolaris 10 Administration PartSolve Problems and Make DecisiSpeed ReadingSQL IntroductionSQL LanguageSQL Server 2005 End to End BusStepping Up to ManagementStructured Business CommunicatSupporting the Microsoft WindoSupporting Users Running AppliSupporting Users Running the MSuse Linux Enterprise 10 AdminSuse Linux Enterprise DesktopSuse Linux Enterprise Server 1Suse Linux Enterprise Server 1Suse Linux Enterprise Server 1Suse Linux Enterprise Server 1SUSE Linux Network Services: SSystem Modelling Techniques (SSystem Modelling Techniques (SSystem Modelling Techniques (USystem Modelling Techniques (USystem TestingSystems Design & ImplementatioSystems Design & ImplementatioSystems Development EssentialsSystems Development EssentialsTeam BuildingTechnical Team LeadingThe Art of InfluenceThe C# 2.0 Programming LanguagThe Organisational Context ExaThe Organisational ContextThe Secret of SuccessThe Unified Modelling LanguageTrade & Logistics I in MicrosoTrade & Logistics II in MicrosTrain the Trainer ITIL VersionTransforming Business ProcesseTransforming XML using XSLT StTripwire Change Auditing UsingTroubleshooting and OptimisingTroubleshooting Cisco UnifiedTroubleshooting Microsoft ExchTuning and Optimising QueriesUnderstand People and ConflictUnderstanding .NETUnderstanding .NETUnderstanding Corporate ComputUnderstanding XMLUnix FundamentalsUNIX ProgrammingUnix System AdministrationUpdating Support Skills from MUpdating System AdministrationUpdating Systems AdministratorUpdating Systems Engineer SkilUpdating your Application PlatUpdating Your Database AdminisUpdating Your Database DevelopUpdating your Network InfrastrUpdating Your Skills from MicrUpgrading to Novell Open EnterUpgrading Web Development SkilUpgrading your Enterprise JavaUpgrading Your Skills from MicUser Acceptance TestingUsing LotusScript in IBM LotusUsing the Perl DBI moduleVBA Programming with MicrosoftVirtual TeamsVisio 2003 AdvancedVisio 2003 IntroVisual Basic 2005 ProgrammingVisual Basic 6 PrimerVMware Deploy, Secure & AnalyzVMWare Fast TrackVMware Infrastructure 3 : SkilVMware Infrastructure 3: InstaVoice over IPWarehouse Management in MicrosWeb AuthoringWeb Programming with HTML4Web Publishing using MacromediWeb Publishing using MicrosoftWebsense Engineer - Web SecurWebsense Certified Engineer WeWebTrends For Technical ProfesWebTrends For Technical ProfesWhat's New - Application in MiWhats New Technical in MicrosWhat's new in Microsoft VisualWide Area Application ServicesWindows Server 2003 Helpdesk EWireless LAN Solutions EngineWord 2000 AdvancedWord 2000 IntermediateWord 2000 IntroductionWord 2002 Level 2Word 2002 Level 1Word 2002 Level 3Word 2003 Level 1Word 2003 Level 2Word 2003 Level 3Word 2003 VBAWord 2007 Level 1Word 2007 Level 2Word 2007 Level 3Write for ResultsWriting Queries Using MicrosofXenSource Training
Course Groups:		[All Groups] ACCOUNTINGAPPLICATIONCERTIFICATIONCOLLABORATIONCOMMUNICATIONSCRMDATA COMMUNICATIONSDATABASEDESKTOP APPLICATIONDESKTOP APPLICATIONSDEVELOPMENTERPHELPDESKITIL SERVICE MANAGEMENTLAN/WAN MANAGEMENTMANAGEMENT AND PERSONAL DEVELOMESSAGINGNetworkingNETWORKSOPERATING SYSTEMSPC FOUNDATIONSPROFESSIONAL BEST PRACTICEPROGRAMMINGPROJECT MANAGEMENTPROJECT/PROGRAM MANAGEMENTSALESSECURITYSHAREPOINTSTORAGESUPPORTSWITCHING AND ROUTINGSYSTEMS MANAGEMENTUNIFIED COMMUNICATIONWEB ACCESSWEB DEVELOPMENTWIRELESS
Keywords: