Search Courses

Please use the following search facility to find the course/s you are looking for.

If you are unsure as to which course you require, please contact us either by telephone on +44 (0)208 335 5919 or Email us at Enquiries@EntegratyLS.Com
.

Filter Options

Course Code:		[All Course Codes] ACT0001APPSENSEBCCPA01BCCPP01BCWAA01BCWAP01CHKPT01CHKPT02CHKPT03CHKPT04CHKPT05CHKPT06CHKPT07CHKPTNOCMPA+ACCMPA+ELCMPA+ESCMPNET+CMPPROJCMPSEC+CMPSERVCRSBM01CRSBM02CRSBM03CRYV10ACRYV10ICRYV11ACRYV11ICRYV9INCSCACCMCSCASRFCSCBMSNCSCBSCICSCCASICSCCBGPCSCCCIECSCCCNACSCCHIPCSCCIDCCSCCIPSCSCCND1CSCCND2CSCCNFCCSCCQOSCSCCSNDCSCCSNPCSCCUCSCSCCUWNCSCCWAACSCCWLFCSCDCISCSCDCNSCSCFXFECSCGWGKCSCICM1CSCICSNSCSCIP42CSCIP52CSCIPCCCSCIPCECSCIPT4CSCIPT5CSCIPTDCSCIPTXCSCMARSCSCMDS9CSCMPLSCSCMSNFCSCOCCNCSCSAESCSCSCWACSCSND1CSCSNDECSCSNPACSCSNRSCSCSSSECSCSVPNCSCUCDNCSCUCSECSCVOICCSCWENTCSCWFSSCSCWLATCSCWLSECTX1012CTX1223CTX1252CTX1256CTX1258CTX1259CTX1266CTX1308CTX1309CTX1327CTX1456CTX1730CTX1731CTX4100CTX41SUCTX6113CTX6114DAPA0VBDAPA2L1DAPA2L2DAPA2L3DAPA3L1DAPA3L2DAPA3L3DAPA3VBDAPA7L1DAPA7L2DAPA7L3DAPA97IDAPAC0ADAPAC0IDAPAC0MDAPE0ADDAPE0INDAPE0MEDAPE0VBDAPE2L1DAPE2L2DAPE2L3DAPE3L1DAPE3L2DAPE3L3DAPE3VBDAPE7L1DAPE7L2DAPE7L3DAPE97ADAPE97DDAPE97PDAPE97VDAPF0ADDAPF0INDAPF2L1DAPF2L2DAPF3L1DAPF3L2DAPO0IMDAPO2L1DAPO2L2DAPO2L3DAPO3L1DAPO3L2DAPO3L3DAPO7L1DAPO7L2DAPO7L3DAPOFF7DAPP0ADDAPP0IMDAPP0INDAPP2L1DAPP2L2DAPP3L1DAPP3L2DAPP7L1DAPP7L2DAPP97EDAPP97IDAPPCF1DAPR0ADDAPR0IMDAPR0INDAPR2L1DAPR2L2DAPR3INDAPR3L1DAPR3L2DAPR7L1DAPU0INDAPV0INDAPV2L1DAPV2L2DAPV2SBDAPV3ADDAPV3INDAPW0ADDAPW0IMDAPW0INDAPW2L1DAPW2L2DAPW2L3DAPW3L1DAPW3L2DAPW3L3DAPW3VBDAPW7L1DAPW7L2DAPW7L3DAPW97ADAPW97IDCMNEPRDCMVOIPF5XBIPAF5XBIPEF5XFRPSFORADCOFORSNDVGENSQLIINTPPROISBITSRISSDSKPISSNIAGISSSPADISSSPINISSSRVPITL1DAWITLAWV3ITLBM23ITLCMEXITLCMEXITLFB23ITLFCV3ITLFND2ITLPMEXITLSDIMITLSMCFITLSMCMITLSMPMITLSMSDITLSMSDITLSMSLITLSMSSJUNAIPSJUNAJSAJUNATPRJUNCJSAJUNCNJFJUNFRVPJUNIIDPJUNINAAJUNNAAPJUNSMF1LGCACDTLGCCFCPLGCCNCPLGCOODCLGCPRG1LGCXML1LGCXML2LGCXML3LOT6310LOT6510LOT6610LOT6750LOT6760LOT6760LOT6770LOT8420LOT8510LOT8520LOT8720LOT8750LOT8760LOT8770LOTBESCLOTD510LOTD520LOTD540LOTD750LOTD760LOTD770MACMX4AMACMX4IMCS03ACMCS03L1MCS03L2MCS2008MCS2009MCS2011MCS2014MCS2028MCS2030MCS2071MCS2072MCS2073MCS2074MCS2087MCS2092MCS2124MCS2126MCS2151MCS2152MCS2207MCS2208MCS2209MCS2210MCS2261MCS2262MCS2272MCS2273MCS2274MCS2275MCS2276MCS2277MCS2278MCS2279MCS2282MCS2283MCS2285MCS2287MCS2289MCS2297MCS2310MCS2311MCS2349MCS2364MCS2373MCS2389MCS2395MCS2400MCS2433MCS2439MCS2524MCS2541MCS2542MCS2543MCS2544MCS2546MCS2547MCS2548MCS2549MCS2550MCS2553MCS2554MCS2555MCS2557MCS2559MCS2565MCS2576MCS2596MCS2597MCS2609MCS2640MCS2663MCS2667MCS2710MCS2717MCS2733MCS2734MCS2778MCS2779MCS2780MCS2781MCS2782MCS2783MCS2784MCS2786MCS2787MCS2788 MCS2789 MCS2790 MCS2791MCS2792MCS2793MCS2794MCS2795MCS2796MCS2797MCS2810MCS2820MCS2821MCS2823MCS2824MCS2830MCS2933MCS2934MCS2956MCS2957MCS3041MCS3938MCS4994MCS4995MCS5047MCS5049MCS5050MCS5051MCS5053MCS5054MCS5058MCS5060MCS5061MCS5105MCS5115MCS5116MCS5118MCS5119MCS5177MCS5178MCS5179MCS5657MCS6415MCS6417MCS6418MCS8019MCS8309MCS8329MCS8332MCS8333MCS8334MCS8337MCS8338MCS8339MCS8339MCS8340MCS8341MCS8342MCS8343MCS8344MCS8345MCS8346MCS8347MCS8348MCS8349MCS8351MCS8352MCS8353MCS8354MCS8355MCS8356MCS8359MCS8362MCS8364MCS8365MCS8366MCS8371MCS8372MCS8375MCS8376MCS8381MCS8382MCS8384MCS8387MCS8388MCS8389MCS8390MCS8391MCS8392MCS8393MCS8394MCS8395MCS8397MCS8398MCS8399MCS8400MCS8402MCS8403MCS8404MCS8405MCS8419MCS8420MCS8421MCS8422MCS8423MCS8424MCS8455MCS8456MCS8472MCS8505MCS8506MCS8507MCS8508MCS8509MCS8510MCS8511MCS8512MCS8513MCS8514MCS8515MCS8516MCS8517MCS8518MCS8519MCS8520MCS8521MCS8522MCS8523MCS8524MCS8525MCS8526MCS8529MCS8530MCS8536MCS8537MCS8538MCS8539MCS8540MCS8541MCS8594MCS8595MCS8596MCS8597MCS8598MCS8599MCS8621MCS8622MCS8623MCS8624MCS8625MCS8626MCS8627MCS8628MCS8629MCS8629MCS8630MCS8631MCS8632MCS8633MCS8634MCS8635MCS8637MCS8639MCS8640MCS8641MCS8642MCS8643MCS8644MCS8645MCS8646MCSB096MCSB166MCSCLUSMCSNAV4MCSO7SPMCSO7SYMCSSG41MCSSPS3MIME001MIME002MIME003MIME004MIME005MIME006MIME007MIME008NGS0001NGS0002NGS0003NOKENMNNOKIPSONOKMUDSNOKNSACNOKNSAFNOKNSAHNOKNSAONOV3057NOV3063NOV3067NOV3067NOV3071NOV3072NOV3073NOV3074NOV3075NOV3077NOV3080NOV3081NOV3082NOV3083NOV3086NOV3089NOV3091NOV3091NOVZCM1ORC10BRORC10GDORC10GQORC10J2ORC10PAORC10PLORC10SQORC10STORC10W1ORC10W2ORC12A1ORC12A2ORC9IPLORC9SQLORCDBFIORCDBIIOSUADPROSUPERPPACOISHPACRCV3PACTTATPACTTS1PBPADDEPBPADFTPBPAE2PBPAEX2PBPBSAUPBPICS2PBPMBP2PBPMBPEPBPOOPRPBPOOU1PBPOOU2PBPQAS2PBPQASMPBPQASRPBPQPBPPBPREQ2PBPREQXPBPSDE2PBPSDEXPBPSDITPBPSDIXPBPSMTSPBPSMTUPBPSMUXPBPSMXPBPSTF2PBPSTSTPBPTOC1PBPTOCXPBPTTT3PBPUAT2PBPUCC2PNTSEC1PRJFPM3PRMFPM3PRMFPM3PRMMPPEPRMPJMNPRMPL-2PRMPMC1PRMPMFNPRMPMIPPRMPMP3PRMPMP5PRMPMPXPRMPMX5PRMPPCMPRMRMW1QAI2K82QAI2K83QAI2K84QAI2K85QAI2K86QAI2K87QAIAASRQAIACS2QAIADJVQAIAMJEQAIAOINQAIASM2QAIASPVQAIASSAQAIASVSQAIAYBCQAIBALEQAIC#PLQAICFPEQAICLU3QAICOEFQAICOPCQAICPREQAICSKIQAIDAJWQAIEN2FQAIEWSIQAIFAV5QAIFNFMQAIFWO2QAIFWORQAIHTM4QAIIGTAQAIIHRPQAIISA6QAIITFUQAIITSEQAIJ2MEQAIJFCPQAIJNCPQAIJPDVQAIJWDWQAILHELQAILMTEQAIMBC1QAIMDSIQAIMMEEQAIMOM5QAIMOSPQAIMP3PQAIMRECQAIMTTEQAINET2QAINETUQAINWWIQAIOM5AQAIOOJVQAIOPOLQAIOYTIQAIPHPIQAIPMNPQAIPNEGQAIPREDQAIPVBAQAIPWIMQAIQAUTQAIS7SAQAISBCOQAISCRIQAISP3AQAISP3DQAISP7OQAISP7UQAISPMDQAISREAQAISSAIQAISSUCQAISUTMQAITBLDQAITBPRQAITTL2QAIUEJBQAIUPCOQAIVB5PQAIVB6PQAIVBEXQAIVN6AQAIVTEAQAIW2K8QAIWFREQAIWPDRQAIWPFRQAIWS3HQAPMCPQAPMCXQAPMSPFQAPMSPPQAPP2FNQAPP2FPQAPP2GBQAPP2RWQAPV2PPQAUADDTQAUBASHQAUFUNDQAULXADQAULXESQAUMUSHQAUPDBIQAUPERL5QAUUXPRQAUUXSARDSDBADRDSEDWCRDSSQL5RDSSQLARDSSQLERDSSQLLSCPASIKSCPASIVSCPESSKSCPESSVSCPNPCMSCPSECCSCPSECESCPSISESCPSISISCPSISKSCPTPDESCPTPDISCPTPDKSOL10PTSOLMT10TRICAUEVMWDSANVMWEIC3VMWFASTVMWOPS3WBTADRPWBTTPESWEBWCEWWEBWSECXENSRCT
Course Name:		[All Courses] 1 Day Microsoft Vista WorkshopAccelerated Migration to ASP.NET 2.0Accelerated Migration to Java Enterprise Edition 5Access 2000 AdvancedAccess 2000 IntermediateAccess 2000 IntroductionAccess 2000 VBAAccess 2002 Level 1Access 2002 Level 2Access 2002 Level 3Access 2003 Level 1Access 2003 Level 2Access 2003 Level 3Access 2003 VBAAccess 2007 Level 1Access 2007 Level 2Access 2007 Level 3ActivIdentity Secure Remote Access CertificationAdministering a Microsoft SQL Server 2000 Database Administering and Automating Microsoft SQL Server 2005 Databases and ServicesAdministering Cisco CallManager V1.0Administering IBM Lotus Domino 6 : Building the InfrastructureAdministering IBM Lotus Domino 6 : Building the InfrastructureAdministering IBM Lotus Domino 6 : Operating PrinciplesAdministering IBM Lotus Domino 6: Managing Servers and UsersAdministering Microsoft SharePoint Portal Server 2003Administering Microsoft Windows SharePoint Services and SharePoint Portal Server ...Administration in Microsoft Dynamics AX 4.0Advanced C++ Development TechniquesAdvanced Consulting SkillsAdvanced Data Access Development with Microsoft Visual Studio 2005Advanced Database SecurityAdvanced Distributed Application Development with Microsoft Visual Studio 2005Advanced Foundations of Microsoft .NET 2.0 DevelopmentAdvanced JavaAdvanced Juniper Networks IPSec VPN Implementations - (AJVI) Advanced Juniper Networks Secure Access - (AJSA) Advanced Linux AdministrationAdvanced Network Infrastructure SecurityAdvanced Perl with CGI and Web ApplicationsAdvanced Scripting For Windows System AdministratorsAdvanced Switching and Routing for Field Engineers Advanced Transact-SQL Programming and Query Tuning for SQL Server 2000 & 2005Advanced Unix Data Tools & TechniquesAdvanced Web Application Development Using Microsoft ASP.Net 1.XAdvanced Web Application Development with Microsoft Visual Studio 2005Advanced Windows Application Development with Microsoft Visual Studio 2005Aironet Wireless LAN Fundamentals & Cisco Aironet Wireless Site SurveyAn Introduction to Scripting For Windows System AdministratorsAnalyzing Requirements and Defining Microsoft .NET Solution ArchitecturesAPM Introductory Certificate in Project ManagementAPMPAPMP ExamAPMP Examination Preparation WorkshopAPMP5 ExamApplication Development Using Visual Basic 6AppSenseArchitecture and Design of Distributed Enterprise SystemsArt of Amazing ServiceAssert Yourself and Build ConfidenceAttack Prevention with Juniper Networks Firewalls - (APJF) Axapta 3.0 AdministrationAxapta 3.0 Bill of MaterialsAxapta 3.0 CRMAxapta 3.0 Development IAxapta 3.0 Development IAxapta 3.0 Development IIAxapta 3.0 Development IIIAxapta 3.0 Development IVAxapta 3.0 Enterprise Portal Development IIAxapta 3.0 Fixed AssetsAxapta 3.0 HRMAxapta 3.0 Install & Configuration 1Axapta 3.0 Install & Configuration 2Axapta 3.0 IntroductionAxapta 3.0 Master PlanningAxapta 3.0 Production 1Axapta 3.0 Production 2Axapta 3.0 Project IAxapta 3.0 Project IIAxapta 3.0 SalesAxapta 3.0 Sales and MarketingAxapta 3.0 Trade and Logistics 1Axapta 3.0 Trade and Logistics 2Axapta 3.0 Warehouse ManagementBasic Administration of Microsoft Windows 2000Being a LeaderBill of Material - Microsoft Dynamics AX 4.0Blue Coat Certified Proxy Administration - BCCPABlue Coat Certified Proxy Professional - BCCPP Blue Coat WAN Acceleration Administrator - BCWAABlue Coat WAN Acceleration Professional - BCWAPBuilding an Effective Web SiteBuilding Applications for the Web using IBM Lotus Domino Designer 7Building Applications for the Web using IBM Lotus Domino Designer 8Building COM+ Applications Using Microsoft .NET Enterprise ServicesBuilding Effective ASP.NET 2 Web Applications using Visual Studio 2005Building Multilayer Switching Networks Building Scalable Cisco Internetworks Building the IBM Lotus Domino 7 InfrastructureBuilding the IBM Lotus Domino 8 InfrastructureBusiness Analysis EssentialsBusiness Analysis Essentials ExamBusiness Portal 2.5 Installation and ConfigurationBusiness Systems Analysis using UMLC ProgrammingC++ for C ProgrammersC++ for non-C ProgrammersCatalyst 6500 Implementation for Data Centre Business SolutionsCCIE Preparation Lab CCNA Boot Camp CheckPoint Certified Security Administration NGX-3CheckPoint Accelerated CCSE - NGXCheckPoint Certified Security Administration NGX-1 CheckPoint Certified Security Administration NGX-2 CheckPoint IntegrityCheckPoint NGX Security Administration On Nokia IP Security PlatformsCheckPoint Provider 1-NGXCheckPoint VSX NGXCisco Advanced Storage Implementation and TroubleshootingCisco ICM Product Training part 1 v7Cisco IP Telephony Design Cisco IP Telephony Express Cisco IP Telephony V4Cisco IP Telephony v4- Part 2 Cisco IP Telephony V5Cisco IP Telephony v5- Part 2 Cisco MDS Storage Networking FundamentalsCisco Networking FundamentalsCisco Sales EssentialsCisco Secure Virtual Private Networks Cisco Storage Network Design EssentialsCisco Unified Communication Systems Engineer Cisco Unified Wireless Networking v4.0Cisco Unity Design and Networking Cisco Voice Over IP Cisco Wireless LAN Advanced TopicCisco Wireless LAN Fundamentals Citrix Access Gateway 4.5 Advanced Edition: AdministrationCitrix Access Gateway 8.0 Enterprise Edition: AdministrationCitrix Access Suite 4.0: Build/Test WorkshopCitrix Access Suite 4:0 AnalysisCitrix Access Suite 4:0 DesignCitrix Metaframe Presentation Server 3.0 Enterprise AdministrationCitrix Metaframe Presentation Server 3.0: Troubleshooting Enterprise Environment ...Citrix Password Manager 4.5Citrix Platinum 4.5 CombinationCitrix Presentation Server 4.0 AdministrationCitrix Presentation Server 4.5 AdministrationCitrix Presentation Server 4.5: Skills Update from XP FR3Citrix Presentation Server 4.5: Skills Update workshop from version 4.0Citrix Presentation Server 4: Advanced SupportClearswift Email ApplianceClearswift Web ApplianceCoaching for PerformanceCOM Programming with C++Communicate EffectivelyCompTIA A+ Certification - Accelerated V11CompTIA A+ Certification : ElectivesCompTIA A+ Certification EssentialsCompTIA IT Project+CompTIA Network+ Certification Support Skills 2005CompTIA Security+ CertificationCompTIA Server+Configuring BGP on Cisco Routers Configuring Juniper Networks Firewall / IPSec VPN Products - (CJFV) Configuring Juniper Networks Secure Access - (CJSA) Configuring Windows Vista Mobile Computing and ApplicationsConsulting SkillsCore Data Access with Microsoft Visual Studio 2005Core Distributed Application Development with Microsoft Visual Studio 2005Core Foundations of Microsoft .NET 2.0 DevelopmentCore Web Application Development with Microsoft Visual Studio 2005Core Windows Application Development with Microsoft Visual Studio 2005Creating Reporting Solutions Using Microsoft SQL 2000 ReportingCreative Positive RelationshipsCrossbeam COS Principles of Operation Crossbeam VSX Workshop Crossbeam XOS Principles of Operation Crystal Reports V10 AdvancedCrystal Reports V10 IntroductionCrystal Reports V11 AdvancedCrystal Reports V11 IntroCrystal Reports Version 9 IntroCustomizing Microsoft SharePoint Products and Technologies 2003Database Analysis and DesignDeploying and Managing Business Process and Integration Solutions Using Microsof ...Deploying Business Desktops with Microsoft Windows XP and Microsoft Office 2003Deploying Microsoft Office Professional Plus 2007Deploying Microsoft Windows Vista and the 2007 Office System Client ProductsDeploying Microsoft Windows Vista Business DesktopsDeploying Windows Server 2008Designing a High Availability Messaging Solution Using Microsoft Exchange Server ...Designing a Messaging Infrastructure Using Microsoft Exchange Server 2007Designing a Microsoft SQL Server 2005 Infrastructure Designing a Microsoft Windows Server 2003 Active Directory and Network Infrastru ...Designing a Reporting Solution Architecture Using Microsoft SQL Server 2005 Rep ...Designing an ETL Solution Architecture Using Microsoft SQL Server 2005Designing an OLAP Solutions Architecture Using Microsoft SQL Server 2005Designing and Implementing OLAP Solutions using Microsoft SQL Server 2000Designing and Managing a Windows Public Key InfrastructureDesigning and Planning an Exchange Server 2003 OrganisationDesigning Business Intelligence Solution Architecture for the Enterprise Using ...Designing Cisco Network Service Architectures Designing for Cisco Internetwork Solutions Designing High Availability Solutions for Microsoft SQL Server 2005Designing Microsoft SQL Server 2005 Databases Designing Microsoft SQL Server 2005 Server-side Solutions Designing Security for Microsoft NetworksDesigning Security for Microsoft SQL Server 2005 Designing the Data Tier for Microsoft SQL Server 2005 Designing, Deploying, and Managing a Network Solution for the Small and Medium-s ...Developing Applications for Java 2 Enterprise EditionDeveloping Business Process and Integration Solutions Using Microsoft BizTalk Se ...Developing Dynamic Web Applications with IBM Lotus Domino 6Developing IBM Lotus Domino 6 Applications: Foundation SkillDeveloping Microsoft .NET Applications for Windows (Visual .NET)Developing Microsoft .NET Applications for Windows (Visual C# .NET)Developing Microsoft ASP.NET Web Applications Using Visual Studio .NETDeveloping Web Applications with Active Server Pages and VBScriptDeveloping Windows Forms Applications using Microsoft Visual Studio 2005Developing XML Web Services Using Microsoft ASP.NETDeveloping XML-Based ApplicationsDevelopment I in Microsoft Dynamics AX 4.0Development II in Microsoft Dynamics AX 4.0Development III in Microsoft Dynamics AX 4.0Development IV in Microsoft Dynamics AX 4.0DreamWeaver MX 2004 AdvancedDreamWeaver MX 2004 IntroductionEdgesight: 4.2 Application Performance Monitoring and AnalysisEffective Data Warehouse ConstructionEndpoint Security with PointsecEnterprise .NET 2.0 Framework DevelopmentEnterprise Extraction, Transformation and Loading with SQL Server 2005 Integrati ...Essentials of Linux AdministrationExcel 2000 AdvancedExcel 2000 IntermediateExcel 2000 IntroExcel 2002 Level 1Excel 2002 Level 2Excel 2002 Level 3Excel 2003 Level 1Excel 2003 Level 2Excel 2003 Level 3Excel 2003 VBAExcel 2007 Level 1Excel 2007 Level 2Excel 2007 Level 3Experience the 2007 Microsoft Office SystemExploring New Features of IBM Lotus Domino 8 AdministrationExploring New Features in IBM Domino Designer 8F5 BIG-IP Local Traffic Manager: Advanced TopicsF5 BIG-IP Local Traffic Manager: EssentialsF5 FirePassFacilitate WorkshopFacilitators WorkshopFinance for Non-Financial ManagersFinancials I in Microsoft Dynamics AX 4.0Financials I in Microsoft Dynamics AX 4.0Financials II - Microsoft Dynamics AX 4.0First Look Getting Started with Branch Office Management in Windows Server 2008First Look Getting Started with Centralised Application Access in Windows Server ...First Look Getting Started with High Availability In Windows Server 2008First Look Getting Started with Security and Policy Control in Windows Server 20 ...First Look Getting Started with Server Management in Windows Server 2008First Look Getting Started with Server Virtualisation in Windows Server 2008First Look Getting Started with Web & Applications Platform Technologies in Wind ...First Look: Getting Started with 2007 Microsoft Office System and Hands on LabFirst Look: Getting Started with Microsoft Office 2007 SharePoint Server and Han ...First Look: Getting Started with Windows SharePoint Services 3 and Hands on LabFortinet FortiGate Multi-Threat Security Systems I-Administration and Content In ...Fortinet FortiGate Multi-Threat Security Systems II-Secured Network Deployment & ...Foundation Certificate in IT Service Management - ITILV3Foundation Express for Field Engineers v1.0Foundations of Novell Open Enterprise Server for NetwareFrontpage 2000 AdvancedFrontpage 2000 IntroductionFrontpage 2002 Level 1Frontpage 2002 Level 2Frontpage 2003 Level 1Frontpage 2003 Level 2FRx 6.7 Report Design Essentials IFRx 6.7 Report Design Essentials IIFundamentals of IBM Lotus Domino 7 Application DevelopmentFundamentals of IBM Lotus Domino 8 Application DevelopmentFundamentals of Network SecurityFundamentals of Project managementFundamentals of Project ManagementGetting Started with PHP and MySQLGetting the Best from PRINCE2Great Plains Project SeriesGreat Plains V8.0 Bank ReconciliationGreat Plains V8.0 Fixed AssetsGreat Plains V8.0 Foundation IGreat Plains V8.0 Foundation IIGreat Plains V8.0 General Ledger IGreat Plains V8.0 General Ledger IIGreat Plains V8.0 Human ResourcesGreat Plains V8.0 Human Resources with PayrollGreat Plains V8.0 Installation and ConfigurationGreat Plains V8.0 Integration ManagerGreat Plains V8.0 Inventory ControlGreat Plains V8.0 Manufacturing ApplicationsGreat Plains V8.0 Modifier with VBAGreat Plains V8.0 Payables Management IGreat Plains V8.0 Payables Management IIGreat Plains V8.0 PayrollGreat Plains V8.0 Receivables Management IGreat Plains V8.0 Receivables Management IIGreat Plains V8.0 Report WriterGreat Plains V8.0 Sales Order ProcessingHalf Day ITIL Awareness V3Half Day ITIL Service Management AwarenessHelp Desk Support for IBM Notes 6IBM Lotus Domino 7 System Administration Operating FundamentalsIBM Lotus Domino 8 System Administration Operating FundamentalsIdentify & Grow TalentImplementing and Maintaining Microsoft SQL Server 2005 Analysis ServicesImplementing & Administering Security in a Microsoft Windows 2000 NetworkImplementing & Administering Security in a Microsoft Windows Server 2003 Network ...Implementing & Supporting Windows XP ProfessionalImplementing a Microsoft SQL Server 2005 Database Implementing a Microsoft Windows Server 2003 Network InfrastructureImplementing and Administering Microsoft Internet Information Services (IIS) 6.0 ...Implementing and Maintaining Audio/Visual Conferencing and Web Conferencing Usin ...Implementing and Maintaining Instant messaging Using Microsoft Office Communicat ...Implementing and Maintaining Microsoft SQL Server 2005 Integration ServicesImplementing and Maintaining Microsoft SQL Server 2005 Reporting ServicesImplementing and Maintaining Telephony Using Microsoft Office Communications Ser ...Implementing and Managing Microsoft Exchange Server 2003Implementing Cisco Intrusion Protection Systems Implementing Cisco MPLS Implementing Cisco Quality of Service Implementing Cisco Storage Network SolutionsImplementing Cisco Voice Gateways and Gatekeepers Implementing Cisco works for LAN/WAN Management Implementing Microsoft Clustering 2003Implementing Microsoft Internet Security and Acceleration Server (ISA) 2004Implementing Microsoft Office SharePoint Server 2007Implementing Microsoft Operations Manager 2000Implementing Microsoft Windows 2000 ClusteringImplementing Microsoft Windows 2000 Professional & ServerImplementing Microsoft Windows Sharepoint Services 3.0Implementing Novell Open Enterprise Server 2Implementing Secure Converged Wide Area Networks Implementing Windows Server 2003 ClusteringImplementing, Managing and Maintaining a Microsoft Windows Server 2003 Network I ...Implementing, Monitoring, Analysis and Response System Install & Configuration - Microsoft Dynamics AX 4.0Installing and Configuring the Windows Vista Operating SystemInstalling, Configuring and Administering Microsoft Windows XP ProfessionalIntegrating Juniper Networks Firewalls and VPNs into High-Performance Networks - ...Intercompany in Microsoft Dynamics AX 4.0Interconnecting Cisco Network Devices V1.0 ICND1Interconnecting Cisco Network Devices v1.0 ICND2Internet Technology FundamentalsInterview and Hire the Right PeopleIntroduction to C# Programming with Microsoft .NETIntroduction to Consulting SkillsIntroduction to Installing and Managing Microsoft Exchange Server 2007Introduction to Microsoft .NET DevelopmentIntroduction to Microsoft Dynamics AX 4.0Introduction to Networking (Network Primer)Introduction to Oracle 9i: SQLIntroduction to Parallel Programming (Intel)Introduction to ProgrammingIntroduction to Programming Microsoft .NET Applications with Microsoft Visual St ...Introduction to Programming with VBAIntroduction to Script Programming with VBScriptIntroduction to Visual Basic .NET Programming with Microsoft .NETIP Contact Centre EnterpriseIPCC 10 day Boot Camp ISA 2006 - New FeaturesISEB Business Analysis Diploma Fast-trackISEB Certificate in Project Management for PRINCE2 Practitioners Revision/Exam ...ISEB Certificate in Project Management for PRINCE2 PractitionersISEB Foundation Certificate in IT ServiceISEB Managers Certifi cate in IT Service Management-Service DeliveryISEB Managers Certificate in IT Service Management- Service SupportISS Advanced SiteProtector 2 SP6 ISS Desktop Protection ISS Introduction To SiteProtector 2 SP6 ISS Network Intrusion Provention Appliance G Series ISS Server Protection IT Security FundamentalsITIL Change Management ExamITIL Configuration Management ExamITIL Foundation (2 Days)ITIL Problem Management ExamITIL Service Desk & Incident Management ExamITIL Service Management AwarenessITIL SM Change ManagementITIL SM Configuration ManagementITIL SM Problem ManagementITIL SM Service Desk & Incident ManagementITIL SM Service Level ManagementITIL V2-V3 Foundation Bridging CourseITIL V2-V3 Managers Bridging CourseJava for C/C++ ProgrammersJava for non-C ProgrammersJava Primer for DevelopersJava Web Development WorkshopJuniper Implementing Intrusion Detection and Prevention - (IIDP) Juniper Implementing the DX Application Acceleration PlatformJuniper Security Manager Fundamentals - (SMF) Lead & Manage TeamsLegendary HelpdesksLotus Bespoke CoursesMaintaining a Microsoft Windows Server 2003 EnvironmentMaintaining and Troubleshooting Windows Vista ComputersMake a Business CaseMake the Transition to Solaris 10Manage Outsourced Service ProvidersManage Projects Involving 3rd PartiesManage Relationships Enable ChangeManage the TeamManagers Certificate in IT Services Management - ITIL Revision DayManaging a Microsoft SQL Server 2005 Database Managing a Microsoft Windows 2000 Network EnvironmentManaging a Microsoft Windows Server 2003 EnvironmentManaging and Maintaining a Microsoft Windows Server 2003 EnvironmentManaging Difficult SituationsManaging IBM Lotus Domino 7 Servers and UsersManaging IBM Lotus Domino 8 Servers and UsersManaging MeetingsManaging Messaging Security Using Microsoft Exchange Server 2007Managing Microsoft Systems Management Server (SMS) 2003Managing People in a Project EnvironmentManaging Successful Programmes (MSP) - Foundation CourseManaging Successful Programmes (MSP) - Practitioner CourseManaging Your Infrastructure Using Microsoft Operations Manager (MOM) 2005Master Planning in Microsoft Dynamics AX 4.0Mastering BASH ScriptsMastering UNIX Shell ScriptsMCSE 2003 AcceleratorMDS 9000 Configuration & TroubleshootingMicrosoft Access 97 IntroductionMicrosoft Business Solutions - Navision 4.0 Development I - C/SIDE IntroductionMicrosoft Business Solutions - Navision 4.0 Financials IMicrosoft Business Solutions - Navision 4.0 Financials IIMicrosoft Business Solutions - Navision 4.0 Warehouse ManagementMicrosoft CRM 1.2 Applications ProfessionalMicrosoft CRM 1.2 .Net Tools to Extend CRMMicrosoft CRM 1.2 Integration for Great Plains 7.5Microsoft CRM 3.0 AdministrationMicrosoft CRM 3.0 CustomizationMicrosoft CRM 3.0 Data MigrationMicrosoft CRM 3.0 Installation & ConfigurationMicrosoft CRM 3.0 Marketing AutomationMicrosoft CRM 3.0 Sales ManagementMicrosoft CRM 3.0 Service ManagementMicrosoft CRM 3.0 Service SchedulingMicrosoft Dynamics GP 9.0 Bank Reconciliation IMicrosoft Dynamics GP 9.0 Business Portal Installation & ConfigurationMicrosoft Dynamics GP 9.0 Field ServiceMicrosoft Dynamics GP 9.0 Field Service - Contract AdministrationMicrosoft Dynamics GP 9.0 Field Service - Depot ManagementMicrosoft Dynamics GP 9.0 Field Service - Preventative MaintenanceMicrosoft Dynamics GP 9.0 Field Service - Returns ManagementMicrosoft Dynamics GP 9.0 Field Service - Service Call ManagementMicrosoft Dynamics GP 9.0 Fixed AssetsMicrosoft Dynamics GP 9.0 Foundation IMicrosoft Dynamics GP 9.0 Foundation IIMicrosoft Dynamics GP 9.0 General Ledger IMicrosoft Dynamics GP 9.0 General Ledger IIMicrosoft Dynamics GP 9.0 Installation & ConfigurationMicrosoft Dynamics GP 9.0 Integration ManagerMicrosoft Dynamics GP 9.0 InventoryMicrosoft Dynamics GP 9.0 Manufacturing ApplicationsMicrosoft Dynamics GP 9.0 Modifier with VBAMicrosoft Dynamics GP 9.0 Payables Management IMicrosoft Dynamics GP 9.0 Payables Management IIMicrosoft Dynamics GP 9.0 Project SeriesMicrosoft Dynamics GP 9.0 Purchase Order ProcessingMicrosoft Dynamics GP 9.0 Receivables Management IMicrosoft Dynamics GP 9.0 Receivables Management IIMicrosoft Dynamics GP 9.0 Report WriterMicrosoft Dynamics GP 9.0 Sales Order ProcessingMicrosoft Excel 2000 VBAMicrosoft Excel 97 AdvancedMicrosoft Excel 97 Data ManagementMicrosoft Excel 97 Presenting InformationMicrosoft Excel 97 Visual Basic for Applications (VBA)Microsoft Operations Manager (MOM) 2005 - Advanced AdministrationMicrosoft Operations Manager (MOM) 2005 - OperatorMicrosoft Powerpoint 97 Enhancing PresentationsMicrosoft Powerpoint 97 IntroductionMicrosoft Project 2003 Level 1Microsoft Project 2003 Level 2Microsoft Publisher 2000 IntroductionMicrosoft Retail Management System 1.3 - HeadquartersMicrosoft Retail Management System 1.3 - Store OperationMicrosoft SoftGrid Platform V4.1 AdministrationMicrosoft Visio 2000 Introduction - StandardMicrosoft Visio 2002 Professional Level 1Microsoft Visio 2002 Professional Level 2Microsoft Visio 2002 Standard BasicMicrosoft Visual Basic Scripting Edition and Microsoft Windows Script Host (WSH) ...Microsoft Windows 2000 Network & Operating System EssentialsMicrosoft Word 97 - IntroductionMicrosoft Word 97 AdvancedMigrating from Microsoft Windows NT to Microsoft Windows Server 2003Migrating to Novell Open Enterprise Server for LinuxMIMEsweeper For SMTP 5.2 CMAMIMEsweeper For SMTP 5.2 CMA to CME UpgradeMIMEsweeper For SMTP 5.2 CMEMIMEsweeper For WEB 5.2 CMA MIMEsweeper For WEB 5.2 CMA to CME Upgrade MIMEsweeper For WEB 5.2 CME Modelling Business ProcessesModelling Business Processes ExamMonitoring and Troubleshooting Microsoft Exchange Server 2007Navision 4.0 Business AnalyticsNavision 4.0 Commerce GatewayNavision 4.0 Commerce PortalNavision 4.0 Employee PortalNavision 4.0 Manufacturing CostingNavision 4.0 Service ManagementNavision V4.0 Business NotificationNavision V4.0 Installation and ConfigurationNavision V4.0 Inventory CostingNavision V4.0 Inventory ManagementNavision V4.0 Job CostingNavision V4.0 TradeNegotiate to Win-WinNetscaler 8.0: AdministrationNetscaler 8.0: Basic OperationsNokia Enterprise Manager Nokia Intrusion Prevention Solution Nokia Multi Domain SecurityNovell eDirectory Design and Implementation: eDirectory 8.8Novell eDirectory Design and Implementation: eDirectory 8.8Novell Groupwise 7 AdministrationNovell Identity Manager 3.5 FundamentalsNovell Identity Manager 3.5 FundamentalsNovell Open Enterprise Server for Netware AdministrationNovell Open Enterprise Server for Netware Advanced AdministrationNovell Zenworks Configuration Manager 10 JumpstartNSA ConnectivityNSA FoundationNSA High AvailabilityNSA Optimisation and ScriptingObject Oriented Primer for Software DevelopersObject-Oriented Design for C++Object-Oriented Design for JavaOne Day ITIL Awareness V3OO Analysis & Design using the Unified Modelling LanguageOperating Juniper Networks WX Application Acceleration PlatformsOptimising Converged Cisco Networks Oracle 10g Build J2EE ApplicationsOracle 10G PL/SQL AdvancedOracle 9i Database Administration Fundamentals IIOracle 9i: Program with PL/SQLOracle Applications Server 10g Release 2 Admin 1Oracle Applications Server 10g Release 2 Admin 2Oracle AS Discover 10g: Create Queries & Reports (Data Warehousing & Bus Int)Oracle Database 10g New Features for 8i Database AdministrationsOracle Database 10g: Administration Workshop IOracle Database 10g: Administration Workshop IIOracle Database 10g: Program with PL/SQLOracle Database 10g: SQL Tuning WorkshopOracle Database 10G:Introduction to SQLOracle Reports Developer 10g: Build ReportsOracle9i Database Administration Fundamentals IOrganisational PoliticsOrganise Your TimeOutlook 2000-IntermediateOutlook 2002 Level 1Outlook 2002 Level 2Outlook 2002 Level 3Outlook 2003 Level 1Outlook 2003 Level 2Outlook 2003 Level 3Outlook 2007 Level 1Outlook 2007 Level 2Outlook 2007 Level 3Packeteer Operating with iShared Packeteer PacketShaper Technical Training: Advanced Traffic Analysis & Troublesh ...Packeteer PacketShaper Technical Training: Specialist Level 1 Packeteer ReportCenter Version 3.0: Installation, Configuration and Use PC Fundamentals V10.4Perl 5 Object Oriented ProgrammingPerl ProgrammingPersuasive NegotiationsPlanning & Deploying Microsoft Systems Management Server (SMS) 2003Planning and Maintaining a Microsoft Windows Server 2003 Network InfrastructurePlanning, Implementing and Maintaining a Microsoft Windows Server 2003 Active Di ...Planning, Implementing, Managing, and Maintaining a Microsoft Windows Server 20 ...PMI PMP Examination Preparation WorkshopPolestar IT Service Management Simulation GamePopulating a Data Warehouse with Microsoft SQL Server 2000PowerPoint 2000 AdvancedPowerPoint 2000 IntermediatePowerPoint 2000 IntroductionPowerPoint 2002 Level 1PowerPoint 2002 Level 2PowerPoint 2003 Level 1PowerPoint 2003 Level 2PowerPoint 2007 Level 1PowerPoint 2007 Level 2Present with ImpactPRINCE2 - FoundationPRINCE2 - Foundation and PractitionerPRINCE2 - PractitionersPRINCE2 - Re-registration Examination WorkshopProcess RedesignProduction Series I in Microsoft Dynamics AX 4.0Production Series II in Microsoft Dynamics AX 4.0Programming a Microsoft SQL Server 2000 Database Programming with C#Programming with J2MEProgramming with Microsoft ADO.NETProgramming with Microsoft Visual Basic .NETProgramming with the Microsoft .NET Framework (Microsoft Visual C#.NET)Programming with the Microsoft .NET Framework using Microsoft Visual Studio 2005 ...Programming with XML in the Microsoft .Net FrameworkProject 2000 AdvancedProject 2000 IntermediateProject 2000 IntroductionProject 2002 Level 1Project 2002 Level 2Project 2003 Level 1Project 2003 Level 2Project 2007 Level 1Project Accounting I in Microsoft Dynamics AX 4.0Project Accounting II in Microsoft Dynamics AX 4.0Project LeadingProject ManagementProject Management for Non-Project ManagersProject Management FundamentalsProject Master ClassProject Planning and Control with Microsoft ProjectPublisher 2003 IntroQuerying Microsoft SQL 2000 with Transact SQLRecovering Messaging Servers and Databases Using Microsoft Exchange Server 2007Reporting and Business Analysis - Microsoft Dynamics AX 4.0Requirements EngineeringRequirements Engineering ExamRisk Management WorkshopSales and Marketing in Microsoft Dynamics AX 4.0SCP Advanced Security Implementation (ASI) Book kitSCP Advanced Security Implementation (ASI) Exam voucherSCP Enterprise Security Solutions (ESS) Book kitSCP Enterprise Security Solutions (ESS) Exam voucherSCP Security Awareness e-LearningSCP Security Awareness in CD FormatSCP Strategic Infrastructure Security (SIS)SCP Strategic Infrastructure Security (SIS) Book Kit PlusSCP Strategic Infrastructure Security (SIS) e-LearningSCP Tactical Perimeter Defense (TPD)SCP Tactical Perimeter Defense (TPD) Book Kit PlusSCP Tactical Perimeter Defense (TPD) e-LearningSCP TPD & SIS Combo PackScripting Microsoft Windows Management Instrumentation (WMI)Secure Web Applications Design & DevelopmentSecuring Cisco Network Devices Securing Cisco Network Devices V1.0Securing Hosts using Cisco Security Agent Securing Networks with Cisco Routers and Switches Securing Networks with PIX and ASA Securing Networks with PIX and ASA v1.0Security Solutions for Systems Engineers Service Management in Microsoft Dynamics AX 4.0SharePoint 2003 - Overview for Decision MakersSharePoint 2003 Site AdministrationSharePoint 2007 for End UsersSharepoint 2007 for Site Administrators (Power User)SharePoint 2007 OverviewSoftware Testing FoundationSolaris 10 Administration Part 1Solve Problems and Make DecisionsSpeed ReadingSQL IntroductionSQL LanguageSQL Server 2005 End to End Business Intelligence WorkshopStepping Up to ManagementStructured Business CommunicationsSupporting the Microsoft Windows Vista Operating System and ApplicationsSupporting Users Running Applications on a Microsoft Windows XP Operating System ...Supporting Users Running the Microsoft Windows XP Operating SystemSuse Linux Enterprise 10 Administration (Novell)Suse Linux Enterprise Desktop 10 AdministrationSuse Linux Enterprise Server 10 Advanced Administration (Novell)Suse Linux Enterprise Server 10 Fundamentals (Novell)Suse Linux Enterprise Server 10 Networking Services (Novell)Suse Linux Enterprise Server 10 Security (Novell)SUSE Linux Network Services: SLES 9System Modelling Techniques (Structured)System Modelling Techniques (Structured) ExamSystem Modelling Techniques (UML)System Modelling Techniques (UML) ExamSystem TestingSystems Design & Implementation TechniquesSystems Design & Implementation Techniques ExamSystems Development EssentialsSystems Development Essentials ExamTeam BuildingTechnical Team LeadingThe Art of InfluenceThe C# 2.0 Programming LanguageThe Organisational ContextThe Organisational Context ExamThe Secret of SuccessThe Unified Modelling Language for Business AnalystsTrade & Logistics I in Microsoft Dynamics AX 4.0Trade & Logistics II in Microsoft Dynamics AX 4.0Train the Trainer ITIL Version 3Transforming Business ProcessesTransforming XML using XSLT Style SheetsTripwire Change Auditing Using Tripwire EnterpriseTroubleshooting and Optimising Database Servers Using Microsoft SQL Server 2005Troubleshooting Cisco Unified Communications SystemsTroubleshooting Microsoft Exchange Server 2003 Tuning and Optimising Queries Using Microsoft SQL Server 2005Understand People and ConflictUnderstanding .NETUnderstanding .NETUnderstanding Corporate ComputingUnderstanding XMLUnix FundamentalsUNIX ProgrammingUnix System AdministrationUpdating Support Skills from Microsoft Windows NT 4.0 to Windows Server 2003Updating System Administration & System Engineer Skills Updating Systems Administrator Skills from Microsoft Windows 2000 to Windows Ser ...Updating Systems Engineer Skills from Microsoft Windows 2000 to Windows Server 2 ...Updating your Application Platform Technology Skills to Windows Server 2008, Cod ...Updating Your Database Administration Skills to Microsoft SQL Server 2005Updating Your Database Development Skills to Microsoft SQL Server 2005Updating your Network Infrastructure Technology Skills to Windows Server 2008, C ...Updating Your Skills from Microsoft Exchange 2000 Server or Microsoft Exchange S ...Upgrading to Novell Open Enterprise Server for NetwareUpgrading Web Development Skills from ASP to Microsoft ASP.NETUpgrading your Enterprise JavaBeans skills to EJB3Upgrading Your Skills from Microsoft Exchange 5.5 to Exchange Server 2003User Acceptance TestingUsing LotusScript in IBM Lotus Domino 7 ApplicationsUsing the Perl DBI moduleVBA Programming with Microsoft ExcelVirtual TeamsVisio 2003 AdvancedVisio 2003 IntroVisual Basic 2005 Programming LanguageVisual Basic 6 PrimerVMware Deploy, Secure & AnalyzeVMWare Fast TrackVMware Infrastructure 3 : Skills for OperatorsVMware Infrastructure 3: Install and ConfigureVoice over IPWarehouse Management in Microsoft Dynamics AX 4.0Web AuthoringWeb Programming with HTML4Web Publishing using Macromedia DreamweaverWeb Publishing using Microsoft FrontPageWebsense Engineer - Web Security (End Users)Websense Certified Engineer Web Security (WCE-WS) - ResellersWebTrends For Technical Professionals: Advanced Reporting (call for dates)WebTrends For Technical Professionals: Essentials (call for dates)What's New - Application in Microsoft Dynamics AX 4.0Whats New Technical in Microsoft Dynamics AX 4.0What's new in Microsoft Visual Studio 2005 for Existing Visual Studio .NET Devel ...Wide Area Application Services V4.0Windows Server 2003 Helpdesk EssentialsWireless LAN Solutions Engine V1.0Word 2000 AdvancedWord 2000 IntermediateWord 2000 IntroductionWord 2002 Level 2Word 2002 Level 1Word 2002 Level 3Word 2003 Level 1Word 2003 Level 2Word 2003 Level 3Word 2003 VBAWord 2007 Level 1Word 2007 Level 2Word 2007 Level 3Write for ResultsWriting Queries Using Microsoft SQL Server 2005 e-Learning collectionXenSource Training
Course Groups:		[All Groups] ACCOUNTINGAPPLICATIONCERTIFICATIONCOLLABORATIONCOMMUNICATIONSCRMDATA COMMUNICATIONSDATABASEDESKTOP APPLICATIONDESKTOP APPLICATIONSDEVELOPMENTERPHELPDESKITIL SERVICE MANAGEMENTLAN/WAN MANAGEMENTMANAGEMENT AND PERSONAL DEVELOPMENTMESSAGINGNetworkingNETWORKSOPERATING SYSTEMSPC FOUNDATIONSPROFESSIONAL BEST PRACTICEPROGRAMMINGPROJECT MANAGEMENTPROJECT/PROGRAM MANAGEMENTSALESSECURITYSHAREPOINTSTORAGESUPPORTSWITCHING AND ROUTINGSYSTEMS MANAGEMENTUNIFIED COMMUNICATIONWEB ACCESSWEB DEVELOPMENTWIRELESS
Keywords: